PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0077s0011.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 249aa    MW: 28589.4 Da    PI: 5.6481
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0077s0011.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-091742082155
                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          k +yps++++  LA+++gL+++q+ +WF N+R ++
  Cagra.0077s0011.1.p 174 KWPYPSEQQKLALAESTGLDQKQINNWFINQRKRH 208
                          569*****************************885 PP

2ELK41.82.3e-14128149122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELK qLlrKYsgyLgsLkqEF+
  Cagra.0077s0011.1.p 128 ELKGQLLRKYSGYLGSLKQEFM 149
                          9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012563.9E-273687IPR005541KNOX2
PfamPF037915.4E-214085IPR005541KNOX2
PROSITE profilePS5121311.174128148IPR005539ELK domain
PfamPF037893.7E-11128149IPR005539ELK domain
SMARTSM011882.8E-8128149IPR005539ELK domain
PROSITE profilePS5007113.151148211IPR001356Homeobox domain
SuperFamilySSF466896.42E-20150226IPR009057Homeodomain-like
SMARTSM003895.3E-13150215IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-28153213IPR009057Homeodomain-like
CDDcd000864.55E-12160212No hitNo description
PfamPF059201.8E-17168207IPR008422Homeobox KN domain
PROSITE patternPS000270186209IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MFKSLLEDHF LTPPEVVVRL EEACSSAAAA AASMGPTGCL GEDPGLDQFM EAYCEMLVKY  60
EQELSKPFKE AMVFLQRVEC QFKSLSLSSP SSFSGYGETA IDRNNNGSSE EEVDMNNEFV  120
DPQAEDRELK GQLLRKYSGY LGSLKQEFMK KRKKGKLPKE ARQQLLDWWS RHYKWPYPSE  180
QQKLALAEST GLDQKQINNW FINQRKRHWK PSEDMQFVVM DATHPHHYFM DNVLGNPFPM  240
DHISSTML*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143152LKQEFMKKRK
2149153KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU323440.0U32344.1 Arabidopsis thaliana Shootmeristemless (STM) mRNA, complete cds.
GenBankAY0808570.0AY080857.1 Arabidopsis thaliana putative homeobox protein (At1g62360) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002886473.11e-179hypothetical protein ARALYDRAFT_338146
SwissprotQ388741e-180STM_ARATH; Homeobox protein SHOOT MERISTEMLESS
TrEMBLD7KUR51e-179D7KUR5_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_20002451e-179(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64732644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-150KNOX/ELK homeobox transcription factor